PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_6930V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 298aa    MW: 32096.3 Da    PI: 4.6597
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_6930V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC51.81.8e-1620942498
             NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                      arikki++ade+v +i+  +Pvl+ska e+f+ +l  +++  +     +t+    ++++v+   +fdfl +iv +
  Pp3c4_6930V3.4.p 20 ARIKKIMQADEEVGKIAVATPVLISKALEMFLQNLCDKTYEITLRRGAKTMSSIHLKQCVQTNSVFDFLQEIVSK 94
                      8**********************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.3E-151979IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.0E-232093IPR009072Histone-fold
SuperFamilySSF471131.12E-182696IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MPSNQCQRAT KSIYLCSSQA RIKKIMQADE EVGKIAVATP VLISKALEMF LQNLCDKTYE  60
ITLRRGAKTM SSIHLKQCVQ TNSVFDFLQE IVSKVPDIGA ETTGEERISG RRKHSDGDDS  120
DEEVLKRPKS EAQSTSGRGR GRGRGRGGGR GRGSNGGASA RFDGVEKAVD SDDAEMDACS  180
PSSDHEGVIL DSIVHFPKPK VEEAVNRDAT PTSSGPASRS SKLHGFDLNI DLDENGEIAP  240
AIDELVAKEE EEQECDGPGN EATKELDVHS DNVLGGTLHM QGSELHSSVH PDEDDYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-1820801575Transcription Regulator NC2 alpha chain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141150RGRGRGGGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.165820.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S143_36V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-41nuclear factor Y, subunit C11